Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00371.1.g00120.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 346aa    MW: 38515.4 Da    PI: 5.2666
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat+   6 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATT 85 
                                   79****************************.99**************95334445667*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWkatgkd+++ + +g + g++ktLvfy+grap ge+tdWvmheyrl  86 TGYWKATGKDRRIAC-DGGVYGVRKTLVFYRGRAPGGERTDWVMHEYRL 133
                                   ***************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-613155IPR003441NAC domain
PROSITE profilePS5100557.2266156IPR003441NAC domain
PfamPF023654.4E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-52116015172NAC domain-containing protein 19
3swm_B6e-52116015172NAC domain-containing protein 19
3swm_C6e-52116015172NAC domain-containing protein 19
3swm_D6e-52116015172NAC domain-containing protein 19
3swp_A6e-52116015172NAC domain-containing protein 19
3swp_B6e-52116015172NAC domain-containing protein 19
3swp_C6e-52116015172NAC domain-containing protein 19
3swp_D6e-52116015172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658556.11e-143PREDICTED: NAC domain-containing protein 67-like
SwissprotA4VCM02e-69NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A096R9061e-143A0A096R906_MAIZE; Uncharacterized protein
STRINGGRMZM2G082709_P011e-143(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number